CD22 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
CD22 Recombinant Protein Swiss-Prot :
P20273 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR Restriction sites :
NdeI-XhoI Background :
CD22 (also known as siglec-2) is a member of the sialic acid-binding immunoglobulin-type lectin (Siglec) family of immunomodulatory receptors. CD22 can bind to its ligand α 2,6-linked sialic acid on different cells (trans interaction) as well as on the same cells (cis interaction). CD22 is predominantly expressed on B cells and functions as an inhibitory co-receptor for the B cell receptor (BCR). After BCR ligation, the tyrosine kinase Lyn is activated and phosphorylates two distal of the four ITIM motifs in the intracellular carboxy-terminal region of CD22, which then recruit tyrosine phosphatases, including SHP-1, to the plasma membrane, and in turn, they get tyrosine-phosphorylated and activated to damp the signaling pathways initiated by BCR ligation. CD22 has been actively pursued as a therapeutic target for autoimmune diseases. Due to almost exclusive expression on B cells, it is also actively pursued as a therapeutic target for multiple B cell malignancies. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~74kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
CD22 Recombinant Protein Swiss-Prot :
P20273 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR Restriction sites :
NdeI-XhoI Background :
CD22 (also known as siglec-2) is a member of the sialic acid-binding immunoglobulin-type lectin (Siglec) family of immunomodulatory receptors. CD22 can bind to its ligand α 2,6-linked sialic acid on different cells (trans interaction) as well as on the same cells (cis interaction). CD22 is predominantly expressed on B cells and functions as an inhibitory co-receptor for the B cell receptor (BCR). After BCR ligation, the tyrosine kinase Lyn is activated and phosphorylates two distal of the four ITIM motifs in the intracellular carboxy-terminal region of CD22, which then recruit tyrosine phosphatases, including SHP-1, to the plasma membrane, and in turn, they get tyrosine-phosphorylated and activated to damp the signaling pathways initiated by BCR ligation. CD22 has been actively pursued as a therapeutic target for autoimmune diseases. Due to almost exclusive expression on B cells, it is also actively pursued as a therapeutic target for multiple B cell malignancies. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~74kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
Blocking peptide available as NCP0191P