Contact us : info@bioworlde.com
Home > Product > T/B-cell surface proteins
CD7 Recombinant Protein NCP0223
Product NameCD7 Recombinant Protein
Catalog No.NCP0223
Swiss-ProtP09564
Host E.coli
TagHis-tag in C-terminal
Restriction sitesNdeI-XhoI
Background
SolublePBS, 4M Urea, PH7.4
Purification&PurityTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Concentration≥0.5mg/ml
Browse similar products>>
Size Price
500ug $638
1mg $1128
Add to cart My orders
Product Name :
CD7 Recombinant Protein
Swiss-Prot :
P09564
Host :
E.coli
Tag :
≥0.5mg/ml
Amino acid Sequence :
AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Restriction sites :
NdeI-XhoI
Background :
CD7 is a type-I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is one of the earliest surface markers to be expressed on the surface of developing T cells and its expression is maintained throughout maturation of multiple T cell subsets and NK cells. Engagement of CD7 through binding its ligand, SECTM1, has been shown to promote tyrosine phosphorylation of its cytoplasmic domain, recruitment of PI3K, and delivery of costimulatory signals for T cell activation. While CD7 is expressed on normal T cells, it is also highly expressed in a variety of T cell malignancies, which has poised it as a potential target of immunotherapy.
Soluble :
PBS, 4M Urea, PH7.4
Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression vector :
pet-22b(+)
BiowMW :
~17kDa
Note :
For research use only, not for use in diagnostic procedure.
concentration :
≥0.5mg/ml
Blocking peptide available as NCP0223P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER