Product Name :
CD116/CSF2RA Recombinant Protein Swiss-Prot :
P15509 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG Restriction sites :
NdeI-XhoI Background :
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (GM-CSF Receptor α), also known as CSF2RA and CD116, is a type 1 transmembrane protein with low affinity for GM-CSF. GM-CSF Receptor α is primarily expressed on myeloid cells, including granulocytes, monocytes, macrophages, and dendritic cells. GM-CSF Receptor α forms a heterodimeric receptor complex with GM-CSF Receptor β, creating the high affinity GM-CSF receptor. Upon dimerization and ligand binding, the β subunit becomes phosphorylated and transduces signals via Jak/STAT and MAPK pathways for cell proliferation, differentiation, and survival. Oligomerization of the high affinity GM-CSF Receptor α/β complex is required for optimal intracellular signal transduction. Soluble GM-CSF Receptor α, either secreted or cleaved from the cell surface, can competitively bind GM-CSF, preventing membrane receptor signaling. Multiple isoforms of GM-CSF Receptor α have been described. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~33kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
CD116/CSF2RA Recombinant Protein Swiss-Prot :
P15509 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG Restriction sites :
NdeI-XhoI Background :
Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (GM-CSF Receptor α), also known as CSF2RA and CD116, is a type 1 transmembrane protein with low affinity for GM-CSF. GM-CSF Receptor α is primarily expressed on myeloid cells, including granulocytes, monocytes, macrophages, and dendritic cells. GM-CSF Receptor α forms a heterodimeric receptor complex with GM-CSF Receptor β, creating the high affinity GM-CSF receptor. Upon dimerization and ligand binding, the β subunit becomes phosphorylated and transduces signals via Jak/STAT and MAPK pathways for cell proliferation, differentiation, and survival. Oligomerization of the high affinity GM-CSF Receptor α/β complex is required for optimal intracellular signal transduction. Soluble GM-CSF Receptor α, either secreted or cleaved from the cell surface, can competitively bind GM-CSF, preventing membrane receptor signaling. Multiple isoforms of GM-CSF Receptor α have been described. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~33kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
Blocking peptide available as NCP0252P

CD116/CSF2RA Recombinant Protein
Datasheet
COA
MSDS
SHIP