Contact us : info@bioworlde.com
Home > Product > T/B-cell surface proteins
CD126 Recombinant Protein NCP0257
Product NameCD126 Recombinant Protein
Catalog No.NCP0257
Swiss-ProtP08887
Host E.coli
TagHis-tag in C-terminal
Restriction sitesNdeI-XhoI
Background
SolublePBS, 4M Urea, PH7.4
Purification&PurityTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Concentration≥0.5mg/ml
Browse similar products>>
Size Price
500ug $638
1mg $1128
Add to cart My orders
Product Name :
CD126 Recombinant Protein
Swiss-Prot :
P08887
Host :
E.coli
Tag :
≥0.5mg/ml
Amino acid Sequence :
LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Restriction sites :
NdeI-XhoI
Background :
The IL-6 receptor is a heterodimeric complex that consists of a ligand-binding IL-6 receptor α (IL-6Rα) subunit and a signaling component, gp130. Binding of IL-6 to IL-6Rα results in dimerization of receptor with gp130 and subsequent STAT3 activation (1). IL-6Rα is cleaved from the cell surface by ADAM17. In humans, soluble IL-6Rα is also generated via alternatively spliced mRNA. Soluble IL-6Rα binds to IL-6 and can stimulate signaling via membrane bound gp130 in a process known as “trans-signaling”. It is through trans-signaling that IL-6 stimulates cells that do not express membrane bound IL-6Rα.
Soluble :
PBS, 4M Urea, PH7.4
Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression vector :
pet-22b(+)
BiowMW :
~38kDa
Note :
For research use only, not for use in diagnostic procedure.
concentration :
≥0.5mg/ml
Blocking peptide available as NCP0257P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER