CD151 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
CD151 Recombinant Protein Swiss-Prot :
P48509 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Restriction sites :
NdeI-XhoI Background :
CD151 (PETA-3, SFA-1) is a member of the evolutionarily conserved tetraspanin family of multipass glycoproteins (TM4SF), highlighted by four transmembrane domains, two extracellular loops, and N/C-termini that reside within the cytoplasm. Identified as the first member of the tetraspanin family to be implicated in tumorigenesis, research studies have demonstrated that CD151 participates in tumor neovascularization, tumor cell cell invasion, and cell adhesion. Furthermore, a positive correlation exists between CD151 expression levels and poor prognosis for tumors of the lung, kidney, and prostate. CD151 is localized predominantly to the plasma membrane and research studies have demonstrated that CD151 exerts its pro-tumorigenic effects, in part, through the modulation of laminin-binding integrins and oncogenic receptor tyrosine kinases, such as c-Met and EGFR. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~12kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
CD151 Recombinant Protein Swiss-Prot :
P48509 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Restriction sites :
NdeI-XhoI Background :
CD151 (PETA-3, SFA-1) is a member of the evolutionarily conserved tetraspanin family of multipass glycoproteins (TM4SF), highlighted by four transmembrane domains, two extracellular loops, and N/C-termini that reside within the cytoplasm. Identified as the first member of the tetraspanin family to be implicated in tumorigenesis, research studies have demonstrated that CD151 participates in tumor neovascularization, tumor cell cell invasion, and cell adhesion. Furthermore, a positive correlation exists between CD151 expression levels and poor prognosis for tumors of the lung, kidney, and prostate. CD151 is localized predominantly to the plasma membrane and research studies have demonstrated that CD151 exerts its pro-tumorigenic effects, in part, through the modulation of laminin-binding integrins and oncogenic receptor tyrosine kinases, such as c-Met and EGFR. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~12kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
Blocking peptide available as NCP0271P