Product Name :
CD158k Recombinant Protein Swiss-Prot :
P43630 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH Restriction sites :
NdeI-XhoI Background :
The killer immunoglobulin-like receptors (KIRs) on natural killer (NK) cells regulate the inhibition and activation of NK-cell responses through recognition of human leukocyte antigen (HLA) class I molecules. KIR3DL1, a receptor for HLA-B antigens with the Bw4 allele, transmits an inhibitory signal to prevent killer cell-mediated cytoxicity. KIR3DL1 encodes a 444 amino acid type I transmembrane protein, containing 3 immunoglobulin-like C2-type domains. Human KIR3DL1 maps to chromosome 19q13.4. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~35kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
CD158k Recombinant Protein Swiss-Prot :
P43630 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLH Restriction sites :
NdeI-XhoI Background :
The killer immunoglobulin-like receptors (KIRs) on natural killer (NK) cells regulate the inhibition and activation of NK-cell responses through recognition of human leukocyte antigen (HLA) class I molecules. KIR3DL1, a receptor for HLA-B antigens with the Bw4 allele, transmits an inhibitory signal to prevent killer cell-mediated cytoxicity. KIR3DL1 encodes a 444 amino acid type I transmembrane protein, containing 3 immunoglobulin-like C2-type domains. Human KIR3DL1 maps to chromosome 19q13.4. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~35kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
Blocking peptide available as NCP0281P

CD158k Recombinant Protein
Datasheet
COA
MSDS
SHIP