Product Name :
CD305 Recombinant Protein Swiss-Prot :
Q6GTX8 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT QRPSDNSHNEHAPASQGLKAEHLY Restriction sites :
NdeI-XhoI Background :
LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~20kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
CD305 Recombinant Protein Swiss-Prot :
Q6GTX8 Host :
E.coli Tag :
≥0.5mg/ml Amino acid Sequence :
QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT QRPSDNSHNEHAPASQGLKAEHLY Restriction sites :
NdeI-XhoI Background :
LAIR-1 is an inhibitory receptor that belongs to the Immunoglobulin superfamily. It has one extracellular Ig-like domain and an intracellular C-terminus with two ITIM (immunoreceptor tyrosine-based inhibitory motif) domains. It is found on peripheral mononuclear cells, including NK, T, and B cells, and is thought to play a negative regulatory role on the cytolytic function of these cells through signaling through collagen ligation. LAIR1 has been noted to be upregulated in renal cell carcinoma, and may play a role in expansion of Th17 cell populations in collagen-rich environments, such as in graft rejection tissue. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~20kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
≥0.5mg/ml
Blocking peptide available as NCP0330P

CD305 Recombinant Protein
Datasheet
COA
MSDS
SHIP