Contact us : info@bioworlde.com
Home > Product > T/B-cell surface proteins
CD210 Recombinant Protein NCP0331
Product NameCD210 Recombinant Protein
Catalog No.NCP0331
Swiss-ProtQ13651
Host E.coli
TagHis-tag
Restriction sitesNdeI-XhoI
Background
SolublePBS, 4M Urea, PH7.4
Purification&PurityTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Concentration
Browse similar products>>
Size Price
500ug/1mg $638/1128
Add to cart My orders
Product Name :
CD210 Recombinant Protein
Swiss-Prot :
Q13651
Host :
E.coli
Tag :
Amino acid Sequence :
HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSY DLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILG KIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEF CVQVKPSVASRSNKGMWSKEECISLTRQYFTVTN
Restriction sites :
NdeI-XhoI
Background :
The IL-10 receptor, IL-10R, is a member of the class II subgroup of the cytokine receptor family and exhibits structural similarity to the interferon receptor. IL-10R is expressed in B cells and T helper cells, as well as in LPS-induced mouse fibroblasts. Overall, mouse IL-10R and human IL-10R share 60% sequence identity at the protein level. Stimulation with IL-10 leads to phosphorylation of JAK1 and Tyk 2 tyrosine kinases. The activated kinases phosphorylate the two tyrosine residues (Tyr 446 and Tyr 496) in the cytoplasmic domain of IL-10Rα. The phosphorylation of these two residues are required for proper function of IL-10R and activation of IL-10E1 signaling. IL-10Rβ is ubiquitously expressed and, in addition to forming the IL-10 heterodimeric receptor, it forms a heterodimeric receptor with an IL-22R subunit and an IL-28R subunit. IL-10R is constitutively expressed on human natural killer (NK) cells and the direct binding of IL-10 potentiates cytokine production by human NK cells.
Soluble :
PBS, 4M Urea, PH7.4
Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression vector :
pet-22b(+)
BiowMW :
~26kDa
Note :
For research use only, not for use in diagnostic procedure.
concentration :
Blocking peptide available as NCP0331P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER