CD277 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
CD277 Recombinant Protein Swiss-Prot :
O00481 Host :
E.coli Tag :
Amino acid Sequence :
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQ SAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSD LHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVI MRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG Restriction sites :
NdeI-XhoI Background :
The Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and CRISPR-associated protein (Cas9) system is an adaptive immune response defense mechanism used by archea and bacteria for the degradation of foreign genetic material. This mechanism can be repurposed for other functions, including genomic engineering for mammalian systems, such as gene knockout (KO) and gene activation. CRISPR Activation Plasmid products enable the identification and upregulation of specific genes by utilizing a D10A and N863A deactivated Cas9 (dCas9) nuclease fused to a VP64 activation domain, in conjunction with sgRNA (MS2), a target-specific sgRNA engineered to bind the MS2-P65-HSF1 fusion protein. This synergistic activation mediator (SAM) transcription activation system provides a robust system to maximize the activation of endogenous gene expression. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~24kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD277 Recombinant Protein Swiss-Prot :
O00481 Host :
E.coli Tag :
Amino acid Sequence :
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQ SAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSD LHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVI MRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG Restriction sites :
NdeI-XhoI Background :
The Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and CRISPR-associated protein (Cas9) system is an adaptive immune response defense mechanism used by archea and bacteria for the degradation of foreign genetic material. This mechanism can be repurposed for other functions, including genomic engineering for mammalian systems, such as gene knockout (KO) and gene activation. CRISPR Activation Plasmid products enable the identification and upregulation of specific genes by utilizing a D10A and N863A deactivated Cas9 (dCas9) nuclease fused to a VP64 activation domain, in conjunction with sgRNA (MS2), a target-specific sgRNA engineered to bind the MS2-P65-HSF1 fusion protein. This synergistic activation mediator (SAM) transcription activation system provides a robust system to maximize the activation of endogenous gene expression. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~24kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0334P