Product Name :
CD84 Recombinant Protein Swiss-Prot :
Q9UIB8 Host :
E.coli Tag :
Amino acid Sequence :
KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNY YERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSL MASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSN NSDSISARQLCADIAMGFRTHHTG Restriction sites :
NdeI-XhoI Background :
The human CD84 gene maps to chromosome 1q23.3 and is composed of at least eight exons, with an exon coding for the 5' UTR and the leader peptide, two exons coding for each of the two extracellular Ig-like domains, an exon encoding the hydrophobic transmembrane region and four exons coding for the cytoplasmic domains. The extracellular Ig-like domains share structural and sequence homology with a group of members of the Ig superfamily that include CD2, CD48, CD58 and Ly9. Five CD84 isoforms have been characterized, including CD84a, CD84b, CD84c, CD84d and CD84e, which are preferentially expressed on B lymphocytes, monocytes and platelets, where they act as their own ligand and are therefore costimulatory molecules. The CD84 isoforms are generated by alternative exon enhancement, reading frame shift and use of cryptic splice sites. The differential expression of potential sites of phosphorylation on the different isoforms may be a way to regulate CD84 activity in signal transduction. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~28kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD84 Recombinant Protein Swiss-Prot :
Q9UIB8 Host :
E.coli Tag :
Amino acid Sequence :
KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNY YERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSL MASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSN NSDSISARQLCADIAMGFRTHHTG Restriction sites :
NdeI-XhoI Background :
The human CD84 gene maps to chromosome 1q23.3 and is composed of at least eight exons, with an exon coding for the 5' UTR and the leader peptide, two exons coding for each of the two extracellular Ig-like domains, an exon encoding the hydrophobic transmembrane region and four exons coding for the cytoplasmic domains. The extracellular Ig-like domains share structural and sequence homology with a group of members of the Ig superfamily that include CD2, CD48, CD58 and Ly9. Five CD84 isoforms have been characterized, including CD84a, CD84b, CD84c, CD84d and CD84e, which are preferentially expressed on B lymphocytes, monocytes and platelets, where they act as their own ligand and are therefore costimulatory molecules. The CD84 isoforms are generated by alternative exon enhancement, reading frame shift and use of cryptic splice sites. The differential expression of potential sites of phosphorylation on the different isoforms may be a way to regulate CD84 activity in signal transduction. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~28kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0336P