Product Name :
CD207 Recombinant Protein Swiss-Prot :
Q9UJ71 Host :
E.coli Tag :
Amino acid Sequence :
PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFL KLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKL LKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYK TAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQ AWNDAPCDKTFLFICKRPYVPSEP Restriction sites :
NdeI-XhoI Background :
Langerin (CD207) is a C-type lectin receptor whose expression is restricted mainly to dendritic cells in the skin including Langerhans cells in the epidermis and langerin+/CD103+ dermal dendritic cells. Langerin is found on the cell surface and within rod-shaped organelles called Birbeck granules, and its expression is required for the formation of Birbeck granules. Langerin recognizes carbohydrate motifs on the surface of pathogens, resulting in endocytosis of the pathogen into Birbeck granules, degradation of the pathogen, and antigen presentation to T cells. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~35kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD207 Recombinant Protein Swiss-Prot :
Q9UJ71 Host :
E.coli Tag :
Amino acid Sequence :
PRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFL KLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKL LKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYK TAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQ AWNDAPCDKTFLFICKRPYVPSEP Restriction sites :
NdeI-XhoI Background :
Langerin (CD207) is a C-type lectin receptor whose expression is restricted mainly to dendritic cells in the skin including Langerhans cells in the epidermis and langerin+/CD103+ dermal dendritic cells. Langerin is found on the cell surface and within rod-shaped organelles called Birbeck granules, and its expression is required for the formation of Birbeck granules. Langerin recognizes carbohydrate motifs on the surface of pathogens, resulting in endocytosis of the pathogen into Birbeck granules, degradation of the pathogen, and antigen presentation to T cells. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~35kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0340P