Product Name :
CD300c Recombinant Protein Swiss-Prot :
Q08708 Host :
E.coli Tag :
Amino acid Sequence :
MGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR Restriction sites :
NdeI-XhoI Background :
CD300 molecules comprise a family of receptors that regulate many immune cell processes. Cross-linking of CD300C by its specific antibody caused cytokine/chemokine production of human monocytes and mast cells. specific engagement of CD300C led to Fc receptor γ-dependent activation of mast cells and monocytes. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~24kDa Note :
For research use only, not for use in diagnostic procedure. concentration :

• 

Blocking peptide available as NCP0347P