CD33 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
CD33 Recombinant Protein Swiss-Prot :
P20138 Host :
E.coli Tag :
Amino acid Sequence :
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNK LDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVH VTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGV VH Restriction sites :
NdeI-XhoI Background :
CD33, a type I transmembrane protein, is a sialic acid-binding Ig-like lectin (Siglec-3) of the Ig superfamily, and human CD33 binds preferentially to alpha-2, 6-linked sialic acid. Upon binding to its ligands CD33 transduces an inhibitory signaling through the immunoreceptor tyrosine-based inhibitory motif (ITIM) in its intracellular domain, inhibiting cellular function such as phagocytosis. In addition, CD33 is also involved in other processes, such as adhesion. Due to its exclusive expression on hematopoietic cells, particularly the myeloid lineage and their progenitors, CD33 has been actively pursued as a therapeutic target against acute myeloid leukemia (AML). CD33 may also be involved in Alzheimer’s Disease. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~33kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD33 Recombinant Protein Swiss-Prot :
P20138 Host :
E.coli Tag :
Amino acid Sequence :
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNK LDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVH VTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGV VH Restriction sites :
NdeI-XhoI Background :
CD33, a type I transmembrane protein, is a sialic acid-binding Ig-like lectin (Siglec-3) of the Ig superfamily, and human CD33 binds preferentially to alpha-2, 6-linked sialic acid. Upon binding to its ligands CD33 transduces an inhibitory signaling through the immunoreceptor tyrosine-based inhibitory motif (ITIM) in its intracellular domain, inhibiting cellular function such as phagocytosis. In addition, CD33 is also involved in other processes, such as adhesion. Due to its exclusive expression on hematopoietic cells, particularly the myeloid lineage and their progenitors, CD33 has been actively pursued as a therapeutic target against acute myeloid leukemia (AML). CD33 may also be involved in Alzheimer’s Disease. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~33kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0351P