Product Name :
CD62E Recombinant Protein Swiss-Prot :
P16581 Host :
E.coli Tag :
Amino acid Sequence :
MWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP Restriction sites :
NdeI-XhoI Background :
Selectins, also designated CD62 antigens, comprise a family of carbohydratebinding proteins involved in mediating cellular interactions with leukocytes. L-Selectin (also designated LECAM-1 or CD62L) is expressed on the majority of B and naive T cells and on most monocytes, neutrophils and eosinophils. L-Selectin interacts with specific carbohydrates expressed by activated endothelial cells. P-Selectin (also designated GMP-140 or CD62P), expressed on activated platelets and endothelial cells, and E-Selectin (also designated ELMA-1 or CD62E), expressed on endothelial cells, exhibit overlapping ligand specificities. E-Selectin is expressed by cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~62kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD62E Recombinant Protein Swiss-Prot :
P16581 Host :
E.coli Tag :
Amino acid Sequence :
MWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP Restriction sites :
NdeI-XhoI Background :
Selectins, also designated CD62 antigens, comprise a family of carbohydratebinding proteins involved in mediating cellular interactions with leukocytes. L-Selectin (also designated LECAM-1 or CD62L) is expressed on the majority of B and naive T cells and on most monocytes, neutrophils and eosinophils. L-Selectin interacts with specific carbohydrates expressed by activated endothelial cells. P-Selectin (also designated GMP-140 or CD62P), expressed on activated platelets and endothelial cells, and E-Selectin (also designated ELMA-1 or CD62E), expressed on endothelial cells, exhibit overlapping ligand specificities. E-Selectin is expressed by cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~62kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0360P

CD62E Recombinant Protein
Datasheet
COA
MSDS
SHIP