Product Name :
HA-His Recombinant Protein Swiss-Prot :
Host :
E.coli Tag :
Amino acid Sequence :
MGMTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGSYPYDVPDYAGSHHHHHH Restriction sites :
NdeI-XhoI Background :
Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pGEX-4T-1(DE3) BiowMW :
~ 37 kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
HA-His Recombinant Protein Swiss-Prot :
Host :
E.coli Tag :
Amino acid Sequence :
MGMTINYQFGDVDAHGAMIRAQAGLLEAEHQAIVRDVLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWAGSYPYDVPDYAGSHHHHHH Restriction sites :
NdeI-XhoI Background :
Soluble :
PBS, 4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pGEX-4T-1(DE3) BiowMW :
~ 37 kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0337P