Contact us : info@bioworlde.com
Home > Product > T/B-cell surface proteins
D14L Recombinant Protein NCP0425
Product NameD14L Recombinant Protein
Catalog No.NCP0425
Swiss-ProtQ77HN7
Host E.coli
TagHis-tag;Sumo-Tag
Restriction sitesNdeI-XhoI
Background
Soluble2M Urea, PH7.4
Purification&PurityTransferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Concentration
Browse similar products>>
Size Price
$638/$1128 $
Add to cart My orders
Product Name :
D14L Recombinant Protein
Swiss-Prot :
Q77HN7
Host :
E.coli
Tag :
Amino acid Sequence :
HMKVESVTFLTLLGIGCVLSYCTIPSRPINMKFKNSVETDANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYIDGSIVTYSCNSGYSLIGNSGVMCSGGEWSNPPTCQIVKCPHPISNGKLLAALE
Restriction sites :
NdeI-XhoI
Background :
Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
Soluble :
2M Urea, PH7.4
Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Expression vector :
pet-22b(+)
BiowMW :
~37kDa
Note :
For research use only, not for use in diagnostic procedure.
concentration :
Blocking peptide available as NCP0425P
COPYRIGHT © 2015-2018 Bioworld Technology, Inc. All rights reserved POLYCLONAL AND MONOCLONAL ANTIBODY CENTER