OCT4 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
OCT4 Recombinant Protein Swiss-Prot :
Q01860 Host :
E.coli Tag :
Amino acid Sequence :
GSMAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLR-LE Restriction sites :
BamHI-XhoI Background :
Oct-4 (POU5F1) is a transcription factor highly expressed in undifferentiated embryonic stem cells and embryonic germ cells. A network of key factors that includes Oct-4, Nanog, and Sox2 is necessary for the maintenance of pluripotent potential, and downregulation of Oct-4 has been shown to trigger cell differentiation. Research studies have demonstrated that Oct-4 is a useful germ cell tumor marker. Oct-4 exists as two splice variants, Oct-4A and Oct-4B. Recent studies have suggested that the Oct-4A isoform has the ability to confer and sustain pluripotency, while Oct-4B may exist in some somatic, non-pluripotent cells. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pSmart-I BiowMW :
For research use only, not for use in diagnostic procedure. Note :
500ug/1mg concentration :
OCT4 Recombinant Protein Swiss-Prot :
Q01860 Host :
E.coli Tag :
Amino acid Sequence :
GSMAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLR-LE Restriction sites :
BamHI-XhoI Background :
Oct-4 (POU5F1) is a transcription factor highly expressed in undifferentiated embryonic stem cells and embryonic germ cells. A network of key factors that includes Oct-4, Nanog, and Sox2 is necessary for the maintenance of pluripotent potential, and downregulation of Oct-4 has been shown to trigger cell differentiation. Research studies have demonstrated that Oct-4 is a useful germ cell tumor marker. Oct-4 exists as two splice variants, Oct-4A and Oct-4B. Recent studies have suggested that the Oct-4A isoform has the ability to confer and sustain pluripotency, while Oct-4B may exist in some somatic, non-pluripotent cells. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pSmart-I BiowMW :
For research use only, not for use in diagnostic procedure. Note :
500ug/1mg concentration :
Blocking peptide available as NCP0456P