Product Name :
ID2 Recombinant Protein Swiss-Prot :
Q02363 Host :
E.coli Tag :
Amino acid Sequence :
HMKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCGLE Restriction sites :
NdeI-XhoI Background :
Inhibitor of DNA-binding-2 (Id2) is a member of the Id proteins which belong to the helix-loop-helix (HLH) protein family. The Id protein functions by binding to specific transcription factors and preventing their dimerization and DNA binding. Id2 interacts with a wide variety of transcription factors including E proteins, TCS, Pax and the tumor suppressor Rb. Id2 has been shown to be important in regulating cellular differentiation, proliferation, development and tumorgenesis. In tumor cells, increased levels of Id2 functionally inactivate Rb, leading to cellular transformation and cancer. Id2 is therefore a promising therapeutic target for treatment of cancer. Soluble :
2M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~15kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
ID2 Recombinant Protein Swiss-Prot :
Q02363 Host :
E.coli Tag :
Amino acid Sequence :
HMKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCGLE Restriction sites :
NdeI-XhoI Background :
Inhibitor of DNA-binding-2 (Id2) is a member of the Id proteins which belong to the helix-loop-helix (HLH) protein family. The Id protein functions by binding to specific transcription factors and preventing their dimerization and DNA binding. Id2 interacts with a wide variety of transcription factors including E proteins, TCS, Pax and the tumor suppressor Rb. Id2 has been shown to be important in regulating cellular differentiation, proliferation, development and tumorgenesis. In tumor cells, increased levels of Id2 functionally inactivate Rb, leading to cellular transformation and cancer. Id2 is therefore a promising therapeutic target for treatment of cancer. Soluble :
2M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~15kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0440P

ID2 Recombinant Protein
Datasheet
COA
MSDS
SHIP