Runx2 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
Runx2 Recombinant Protein Swiss-Prot :
Q13950 Host :
E.coli Tag :
Amino acid Sequence :
HMKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRILE Restriction sites :
NdeI-XhoI Background :
Runt-related transcription factor 2 (RUNX2) is a member of the RUNX family of transcription factors. It is involved in osteoblast differentiation and skeletal morphogenesis. RUNX2 regulates the transcription of various genes, including osteopontin, bone sialoprotein, and osteocalcin, via binding to the core site of the enhancers or promoters. RUNX2 is crucial for the maturation of osteoblasts and both intramembranous and endochondral ossification. Mutations in the corresponding RUNX2 gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). RUNX2 is also abnormally expressed in various human cancers including prostate cancer and breast cancer. It plays an important role in migration, invasion, and bone metastasis of prostate and breast cancer cells. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~13kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Runx2 Recombinant Protein Swiss-Prot :
Q13950 Host :
E.coli Tag :
Amino acid Sequence :
HMKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRILE Restriction sites :
NdeI-XhoI Background :
Runt-related transcription factor 2 (RUNX2) is a member of the RUNX family of transcription factors. It is involved in osteoblast differentiation and skeletal morphogenesis. RUNX2 regulates the transcription of various genes, including osteopontin, bone sialoprotein, and osteocalcin, via binding to the core site of the enhancers or promoters. RUNX2 is crucial for the maturation of osteoblasts and both intramembranous and endochondral ossification. Mutations in the corresponding RUNX2 gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). RUNX2 is also abnormally expressed in various human cancers including prostate cancer and breast cancer. It plays an important role in migration, invasion, and bone metastasis of prostate and breast cancer cells. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~13kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0442P