FUCT Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
FUCT Recombinant Protein Swiss-Prot :
P22083 Host :
E.coli Tag :
Amino acid Sequence :
HMCWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFERLE Restriction sites :
NdeI-XhoI Background :
SSEA1 antibody detects a lactoseries oligosaccharide antigen that is expressed on the surface of mouse embryonal carcinoma and embryonic stem cells. This antigen is also found on early mouse embryos and both mouse and human germ cells, but is absent on human embryonic stem and carcinoma cells. Expression of SSEA1 in these human cell types increases upon differentiation, while on the mouse cell types differentiation leads to decreased expression. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~42kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
FUCT Recombinant Protein Swiss-Prot :
P22083 Host :
E.coli Tag :
Amino acid Sequence :
HMCWGQLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLDYITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPAVYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFERLE Restriction sites :
NdeI-XhoI Background :
SSEA1 antibody detects a lactoseries oligosaccharide antigen that is expressed on the surface of mouse embryonal carcinoma and embryonic stem cells. This antigen is also found on early mouse embryos and both mouse and human germ cells, but is absent on human embryonic stem and carcinoma cells. Expression of SSEA1 in these human cell types increases upon differentiation, while on the mouse cell types differentiation leads to decreased expression. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~42kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0445P