SNAI2 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
SNAI2 Recombinant Protein Swiss-Prot :
O43623 Host :
E.coli Tag :
Amino acid Sequence :
HMPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAHLE Restriction sites :
NdeI-XhoI Background :
Slug (SNAI2) is a widely expressed transcriptional repressor and member of the Snail family of zinc finger transcription factors. Similar to the related Snail protein, Slug binds to the E-cadherin promoter region to repress transcription during development. The binding of Slug to integrin promoter sequences represses integrin expression and results in reduced cell adhesion. Down regulation of E-cadherin expression occurs during the epithelial-mesenchymal transition during embryonic development, a process also exploited by invasive cancer cells. The tumor suppressor protein p53 induces Slug expression in γ-irradiated cells; Slug protects damaged cells from apoptosis by repressing p53-induced transcription of the proapoptotic Bcl-2 family protein Puma. Deletion mutations in the corresponding Slug gene are associated with the pigmentation disorders Waardenburg Syndrome and Piebaldism, while a genetic duplication resulting in Slug overexpression is associated with a collection of congenital heart defects termed tetralogy of Fallot. Soluble :
4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~29kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
SNAI2 Recombinant Protein Swiss-Prot :
O43623 Host :
E.coli Tag :
Amino acid Sequence :
HMPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAHLE Restriction sites :
NdeI-XhoI Background :
Slug (SNAI2) is a widely expressed transcriptional repressor and member of the Snail family of zinc finger transcription factors. Similar to the related Snail protein, Slug binds to the E-cadherin promoter region to repress transcription during development. The binding of Slug to integrin promoter sequences represses integrin expression and results in reduced cell adhesion. Down regulation of E-cadherin expression occurs during the epithelial-mesenchymal transition during embryonic development, a process also exploited by invasive cancer cells. The tumor suppressor protein p53 induces Slug expression in γ-irradiated cells; Slug protects damaged cells from apoptosis by repressing p53-induced transcription of the proapoptotic Bcl-2 family protein Puma. Deletion mutations in the corresponding Slug gene are associated with the pigmentation disorders Waardenburg Syndrome and Piebaldism, while a genetic duplication resulting in Slug overexpression is associated with a collection of congenital heart defects termed tetralogy of Fallot. Soluble :
4M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~29kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0446P