SNAI1 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
SNAI1 Recombinant Protein Swiss-Prot :
O95863 Host :
E.coli Tag :
Amino acid Sequence :
HMPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPRLE Restriction sites :
NdeI-XhoI Background :
Snail is a zinc-finger transcription factor that can repress E-cadherin transcription. Downregulation of E-cadherin is associated with epithelial-mesenchymal transition during embryonic development, a process also exploited by invasive cancer cells. Indeed, loss of E-cadherin expression is correlated with the invasive properties of some tumors and there is a considerable inverse correlation between Snail and E-cadherin mRNA levels in epithelial tumor cell lines. In addition, Snail blocks the cell cycle and confers resistance to cell death. Phosphorylation of Snail by GSK-3 and PAK1 regulates its stability, cellular localization and function. Soluble :
2M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~29kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
SNAI1 Recombinant Protein Swiss-Prot :
O95863 Host :
E.coli Tag :
Amino acid Sequence :
HMPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPRLE Restriction sites :
NdeI-XhoI Background :
Snail is a zinc-finger transcription factor that can repress E-cadherin transcription. Downregulation of E-cadherin is associated with epithelial-mesenchymal transition during embryonic development, a process also exploited by invasive cancer cells. Indeed, loss of E-cadherin expression is correlated with the invasive properties of some tumors and there is a considerable inverse correlation between Snail and E-cadherin mRNA levels in epithelial tumor cell lines. In addition, Snail blocks the cell cycle and confers resistance to cell death. Phosphorylation of Snail by GSK-3 and PAK1 regulates its stability, cellular localization and function. Soluble :
2M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~29kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0447P