CD53 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
CD53 Recombinant Protein Swiss-Prot :
P19397 Host :
E.coli Tag :
Amino acid Sequence :
HMEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSN-LE Restriction sites :
NdeI-XhoI Background :
Required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~9kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD53 Recombinant Protein Swiss-Prot :
P19397 Host :
E.coli Tag :
Amino acid Sequence :
HMEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSN-LE Restriction sites :
NdeI-XhoI Background :
Required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pet-22b(+) BiowMW :
~9kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0449P