CD298 Recombinant Protein 
Datasheet
COA
MSDS
SHIP
Product Name :
CD298 Recombinant Protein Swiss-Prot :
P54709 Host :
E.coli Tag :
Amino acid Sequence :
GSMGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA-LE Restriction sites :
BamHI-XhoI Background :
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-3 subunit is not known. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pSmart-I BiowMW :
~26kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD298 Recombinant Protein Swiss-Prot :
P54709 Host :
E.coli Tag :
Amino acid Sequence :
GSMGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA-LE Restriction sites :
BamHI-XhoI Background :
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The exact function of the beta-3 subunit is not known. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pSmart-I BiowMW :
~26kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0450P