Product Name :
CD315 Recombinant Protein Swiss-Prot :
Q9P2B2 Host :
E.coli Tag :
Amino acid Sequence :
GSMHVDARSYHLLVRDVSKENSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHTDTFNF-LE Restriction sites :
BamHI-XhoI Background :
Inhibits the binding of prostaglandin F2-alpha (PGF2-alpha) to its specific FP receptor, by decreasing the receptor number rather than the affinity constant. Functional coupling with the prostaglandin F2-alpha receptor seems to occur. In myoblasts, associates with tetraspanins CD9 and CD81 to prevent myotube fusion during muscle regeneration. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pSmart-I BiowMW :
~31kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
CD315 Recombinant Protein Swiss-Prot :
Q9P2B2 Host :
E.coli Tag :
Amino acid Sequence :
GSMHVDARSYHLLVRDVSKENSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHTDTFNF-LE Restriction sites :
BamHI-XhoI Background :
Inhibits the binding of prostaglandin F2-alpha (PGF2-alpha) to its specific FP receptor, by decreasing the receptor number rather than the affinity constant. Functional coupling with the prostaglandin F2-alpha receptor seems to occur. In myoblasts, associates with tetraspanins CD9 and CD81 to prevent myotube fusion during muscle regeneration. Soluble :
0.5M Urea, PH7.4 Purification&Purity :
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). Storage&Stability :
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. Expression vector :
pSmart-I BiowMW :
~31kDa Note :
For research use only, not for use in diagnostic procedure. concentration :
Blocking peptide available as NCP0452P

CD315 Recombinant Protein
Datasheet
COA
MSDS
SHIP